PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Phvul.006G140900.1
Common NamePHAVU_006G140900g
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Phaseoleae; Phaseolus
Family MYB_related
Protein Properties Length: 561aa    MW: 62441.3 Da    PI: 7.34
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Phvul.006G140900.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding34.25.7e-11108149446
                         S-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHH CS
     Myb_DNA-binding   4 WTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqk 46 
                         W ++++ ll+++++++G g+W+ +a+++g ++  ++c++++ +
  Phvul.006G140900.1 108 WNADDEILLLEGIEMYGLGNWTEVAEHVG-TKNKESCIEHYKN 149
                         *****************************.***********98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0250245.1E-15235559IPR016827Transcriptional adaptor 2
SMARTSM002911.1E-114489IPR000433Zinc finger, ZZ-type
PfamPF005691.7E-94688IPR000433Zinc finger, ZZ-type
PROSITE profilePS5013510.9594891IPR000433Zinc finger, ZZ-type
CDDcd023355.92E-274896No hitNo description
SuperFamilySSF578501.11E-1448110No hitNo description
PROSITE patternPS0135705077IPR000433Zinc finger, ZZ-type
SuperFamilySSF466897.18E-12101154IPR009057Homeodomain-like
PROSITE profilePS5129321.756103155IPR017884SANT domain
SMARTSM007171.3E-10104153IPR001005SANT/Myb domain
PfamPF002491.5E-10107149IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.604.0E-7108150IPR009057Homeodomain-like
CDDcd001675.69E-11108150No hitNo description
SuperFamilySSF466892.51E-15466557IPR009057Homeodomain-like
PROSITE profilePS509348.749473560IPR007526SWIRM domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006357Biological Processregulation of transcription from RNA polymerase II promoter
GO:0009631Biological Processcold acclimation
GO:0009733Biological Processresponse to auxin
GO:0009735Biological Processresponse to cytokinin
GO:0016573Biological Processhistone acetylation
GO:0042127Biological Processregulation of cell proliferation
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003713Molecular Functiontranscription coactivator activity
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 561 aa     Download sequence    Send to blast
MGRSRGNFHH ADEDPNQRSR RKKNAASGEN SESGAAGQGA GEGKKALYHC NYCNKDITGK  60
IRIKCAMCPD FDLCIECFSV GAEVTPHKSN HPYRVMDNLS FPLICPDWNA DDEILLLEGI  120
EMYGLGNWTE VAEHVGTKNK ESCIEHYKNI YLSSPFFPVP DMSHVVGKNR KELLAMAKGQ  180
GEDKKGISMG DLSLKAESPF SPSRAKVEDS HKAGSTNRLS SNLNSELDSG PSGNTHSAAG  240
ANQKASHARG KGGPGIIKME DSQIDRDFGG KKPTSSGNEG PSLVELSGYN AKRQEFDPEY  300
DNDAEQLLAE MEFKDTDSEE ERELKLRVLR LYSKRLDERK RRKDFILERN LLYPNPLEKD  360
LTPEEKAICR KYDIFMRFHS KEDHDELLRT MLFEHRSWKK IQELKEARIA GCRNSAEADR  420
YISSKRKREA EENVRRTRTK ESAQVGPSNQ GIPNALTSPD SAGKDTSARP AGPATSSSVN  480
EMDVIGYSGA DLLCEAEKRL CCELRLSPAM YLKMQEQLSL QILAGTVSAK SDAHKLFNKL  540
DAIKIDRVYD MLIKKGIGLP *
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1338343RKRRKD
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAP0150381e-103AP015038.1 Vigna angularis var. angularis DNA, chromosome 5, almost complete sequence, cultivar: Shumari.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_007147630.10.0hypothetical protein PHAVU_006G140900g
SwissprotQ75LL60.0TADA2_ORYSJ; Transcriptional adapter ADA2
TrEMBLV7BNQ10.0V7BNQ1_PHAVU; Uncharacterized protein
STRINGGLYMA15G12400.10.0(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15371726